PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000241840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Dof
Protein Properties Length: 444aa    MW: 48036.5 Da    PI: 8.9243
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000241840genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.5e-38152211362
         zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    ++alkcprCds ntkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+s+
  MDP0000241840 152 QHALKCPRCDSLNTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKTKRSK 211
                    6789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28150209IPR003851Zinc finger, Dof-type
PfamPF027014.5E-33153209IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.562155209IPR003851Zinc finger, Dof-type
PROSITE patternPS013610157193IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MLILMTQPSH PSFDDKLLAR EEVVKNSPLA FRNVAPSPPD SLLSADKIRV ADKAAIPLPS  60
RRPRVVNQRL DLIPLPRFHT ILIFVRPFRS FSALRALVSV AVSFACVVGR NCSLSTWVIE  120
MQDIHSVRGG GRFFGGSGGG DPRLRPHQHP NQHALKCPRC DSLNTKFCYY NNYNLSQPRH  180
FCKACRRYWT KGGVLRNVPV GGGCRKTKRS KTKNSSSSSP ISSPPPPPPQ PSSADQNKSS  240
SRSSSESSSL TNTTAAAATA ATEAVSEPSS TGSASNLLSN IHNPESNFFI SQGGANGGFE  300
PGASAAALLE HSTEINGIFS EIGSFTSLIT SSNDMPFSFG NINGSPFNQQ GNHDHNQVHQ  360
TQWGQQNQGV KMQEISGGLL DQTAQVDLSV FQNRSHVGGG GFGSLDWQPG SGDQGLFDLP  420
NTVDQAYWSH SQWTDQDHPT LYLP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.123880.0fruit| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572543e-62DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374670.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLD9ZIX70.0D9ZIX7_MALDO; DOF domain class transcription factor
STRINGPOPTR_0015s03520.16e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.14e-38OBF binding protein 4